GLP-1 10mg

GLP-1  – Research Peptide Overview

Chemical Information

• Compound Name: GLP-1

• Synonyms: NN9535; Glucagon-Like Peptide-1 analog

• Chemical Formula: C187H291N45O59

• Molecular Weight: 4113.58 g/mol

• CAS Number: 910463-68-2

• Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG – (GLP-1 analog with fatty acid modification)

• Form: Lyophilized powder or sterile injectable solution for in vitro research use only

---

Research Summary

GLP-1 is a long-acting glucagon-like peptide-1 receptor agonist (GLP-1 RA) designed for metabolic and endocrine research applications. Structurally modified for enhanced stability and extended plasma half-life, GLP-1 analogs are utilized to study cellular mechanisms involved in insulin signaling, energy balance, and appetite control.

Preclinical research shows that GLP-1 analogs support investigations related to:

• Glucose regulation and insulin response

• Appetite and caloric intake

• Energy metabolism and body weight modulation

• Pancreatic β-cell function

• Lipid and cardiovascular markers

---

Mechanism of Action (Research Context)

GLP-1 acts by binding to GLP-1 receptors, leading to increased cAMP production, which stimulates glucose-dependent insulin secretion while suppressing glucagon release. This dual action makes it an important research target for studying glucose homeostasis, metabolic pathways, and endocrine signaling.

Supporting Literature:

• PubMed: GLP-1 receptor pharmacology and signaling

• PubMed: Structural analysis of GLP-1 analogs

• PubMed: Mechanistic studies on GLP-1 receptor activation

---

Potential Research Applications

1. Metabolic Research – Study of glucose homeostasis and insulin signaling.

2. Appetite Regulation – Exploration of hypothalamic GLP-1 pathways.

3. Endocrine Function – Investigation of pancreatic β-cell survival and function.

4. Cardiometabolic Research – Evaluation of lipid metabolism and vascular function.

5. Pharmacodynamics – Study of receptor affinity, degradation resistance, and half-life.

---

Storage and Handling

• Storage: –20°C (lyophilized); 2–8°C (reconstituted).

• Solubility: Soluble in sterile or bacteriostatic water.

• Stability: Protect from light and moisture; stable for short-term research use.

---

Specifications

---

Safety Information

For laboratory research only. Handle with gloves and protective eyewear. Avoid inhalation and direct contact with skin or mucosa. Dispose of materials per institutional biosafety guidelines.

---

Research Disclaimer

This product is provided for research use only. It is not approved by the FDA for human consumption, medical, or veterinary applications. GLP-1 is intended solely for in vitro testing and controlled animal studies. Information provided is for educational and scientific purposes to support qualified research professionals.